PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G158600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 447aa    MW: 46896.3 Da    PI: 6.2894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G158600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.8e-1994140148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+WT+eEde l++ vk +G + W++++++++ gR +kqc++rw ++l
  Sevir.9G158600.1.p  94 RGPWTEEEDETLKEMVKVYGERKWAAVSQHLP-GRIGKQCRERWTNHL 140
                         89******************************.************996 PP

2Myb_DNA-binding48.42.2e-15149188445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         WT+ +d  l++a+k +G++ W+ Iar ++ gR+++ +k++w+
  Sevir.9G158600.1.p 149 WTENDDIELIKAHKIHGNR-WSMIARQLP-GRSENAVKNHWN 188
                         *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.36589144IPR017930Myb domain
SuperFamilySSF466898.59E-3092187IPR009057Homeodomain-like
SMARTSM007173.8E-1893142IPR001005SANT/Myb domain
PfamPF002491.3E-1794140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2495145IPR009057Homeodomain-like
CDDcd001671.28E-1696140No hitNo description
SMARTSM007171.2E-13145193IPR001005SANT/Myb domain
PROSITE profilePS5129417.039145195IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-18146192IPR009057Homeodomain-like
PfamPF002491.8E-12149188IPR001005SANT/Myb domain
CDDcd001675.85E-12149191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MDSGSSVRFV QGVATGPVHL GGGAAAAAAH QVMPGTGMTI PAGMGSLLLG AGGGYLAPTG  60
YGTVPANVVH AAWTGGQQQQ ARAGGAVMRP PTLRGPWTEE EDETLKEMVK VYGERKWAAV  120
SQHLPGRIGK QCRERWTNHL RPDIDKTIWT ENDDIELIKA HKIHGNRWSM IARQLPGRSE  180
NAVKNHWNAT KRSLKAKRRL KKKKNAEAPP GQQWSILEQY IRSLPPAAVA EDGAGAAPQQ  240
APSDDSPPSS YNTGGGYYGG EVVSPPLAPA AAGFDPAALG MYLSAAAGNN PSSAAAAVNL  300
GAMNPDLAPP SYLGLDLNSY YYYGGAPLAP AARAPPPQMM MMEQDQQDSS NASNSNNLIT  360
YPFVDHMAWQ SSSVHADAYY ANSASAGHYP YYYYGDAAGA GPSGGGGAGG DATAIPDDVD  420
VVQMASREFQ MNPSEDEVTL NLAGFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-42901903103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986358.11e-163PREDICTED: transcription factor MYB98-like
TrEMBLK4ALU70.0K4ALU7_SETIT; Uncharacterized protein
STRINGSi039882m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.27e-40myb domain protein 3r-3